Sea Cliff Photos










Sea Cliff Introduce
Welcome to the essential guide for homeowners and business owners across Long Island and the greater New York region. When disaster strikes—be it a sudden pipe burst, a hidden mold problem, or the devastation of a fire—having a reliable, professional restoration partner is crucial for a fast and effective recovery. Located right in the heart of Sea Cliff, New York, Sea Cliff Restoration stands out as a leading expert dedicated to bringing your property back to its pre-loss condition, and often, even better.
The experience of property damage is intensely stressful. It involves more than just physical damage; it’s about disruption to your life, potential health hazards, and the complex process of dealing with insurance claims and structural repairs. That is precisely why a company offering comprehensive and empathetic service is so vital. Sea Cliff Restoration is dedicated to mitigating the immediate harm, thoroughly cleaning up the damage, and completely restoring your property with a high level of expertise and personal care. We understand the unique challenges faced by properties in Nassau County, from historic homes to modern commercial spaces, and we tailor our services to meet the specific demands of the New York climate and construction standards.
Our reputation is built on swift response times, technical excellence, and a commitment to customer satisfaction. We’ve been helping local residents navigate the aftermath of property emergencies for years, focusing on a clear, step-by-step process that removes the chaos and restores order. This professional and friendly approach is what makes us a trusted name for property owners seeking peace of mind during a difficult time. Whether the issue is large-scale flooding that threatens your basement or the insidious growth of mold in a damp area, our certified technicians are equipped with the advanced tools and training necessary to handle any emergency.
Conveniently situated to serve the communities of Nassau County and beyond, the main operations center for this essential service is easily accessible. A local presence means faster response times, which is paramount in any property damage scenario, as every hour counts in preventing secondary damage like mold growth after water intrusion.
The central location ensures that help is never far away for those in need of emergency services, whether you are in Sea Cliff, Glen Cove, Roslyn, or other parts of Long Island. The local focus also means the team has a deep understanding of local building codes, weather patterns, and insurance expectations specific to the New York area, providing an invaluable advantage to clients during the restoration process.
For clients who may need to visit the location or who have mobility concerns, the facility at the provided address demonstrates a commitment to accessibility.
Address: 365 Glen Cove Ave, Sea Cliff, NY 11579, USA
A crucial feature for easy access is:
- Wheelchair accessible parking lot
This accessibility ensures that all clients, regardless of physical ability, can manage the logistics of their restoration project comfortably and efficiently.
While a range of property damage restoration services are essential for Long Island residents, Sea Cliff Restoration specializes in handling major emergency situations. Their core expertise spans multiple critical areas, addressing some of the most challenging problems a property owner can face.
The core services provided by Sea Cliff Restoration include:
- Fire Damage Restoration Service: This covers the initial assessment, emergency board-up, structural shoring, and the full scope of cleanup and repair work necessary after a fire event.
- Fire Damage Cleanup & Repair: Detailed removal of soot and smoke residue, odor elimination using professional-grade equipment, and full structural repair to rebuild damaged areas.
- Water Damage Restoration (Implied by Customer Review): Based on customer testimonials, the company expertly handles water extraction, drying, dehumidification, and repair following pipe bursts, leaks, or flooding.
- Mold Remediation and Cleanup (Implied by Customer Review): Services include mold inspection, containment, removal of contaminated materials, treatment of affected areas, and prevention strategies to ensure the safe and healthy return of your property.
- Structural Drying and Dehumidification: Utilizing industrial-grade equipment to remove all residual moisture from walls, flooring, and structural materials, which is key to preventing long-term damage and mold growth.
- Emergency Response Services: Quick deployment of expert teams to stabilize the damage scene 24/7, minimizing the potential for further loss.
- Insurance Claim Assistance: Working closely with homeowners' and business insurance companies to help document the damage, process claims, and ensure a smooth financial recovery.
Choosing a restoration service goes beyond just the immediate cleanup; it’s about partnering with a team that offers competence, reliability, and peace of mind. Sea Cliff Restoration offers several features that make them an excellent choice for New York property owners dealing with an unexpected emergency:
- Expert Fire Damage Focus: Specialization in the complex cleanup and repair required after a fire, including soot removal and smoke odor neutralization, which demands highly specialized tools and training.
- Proven Track Record in Water and Mold Recovery: Customer experiences highlight efficient, prompt action in water damage emergencies, from water removal to complete drying, coupled with effective mold remediation that targets the source of the problem.
- Commitment to Structural Integrity: Beyond cleaning, the company ensures the underlying structure, such as attic beams or basement floors, is sound and safe following damage from water, fire, or mold.
- Comprehensive Repair Recommendations: As noted in customer feedback, the team is proactive in not only fixing the immediate damage but also recommending necessary subsequent repairs, such as replacing damaged insulation.
- Professional, Vetted Process: The focus on thoroughness—killing all mold, repairing structural parts, and setting up rapid drying equipment—demonstrates a commitment to industry best practices.
- Local New York Experience: Understanding the distinct challenges of properties on Long Island, which often include older constructions prone to certain types of leaks and mold issues.
- Accessibility on Site: Offering a wheelchair accessible parking lot at their main location, demonstrating consideration for all clients’ needs.
In an emergency, immediate contact is essential. For fast, professional service in Sea Cliff and the surrounding Long Island communities, use the following contact details:
Address: 365 Glen Cove Ave, Sea Cliff, NY 11579, USA
Phone: (516) 299-8455
Mobile Phone: +1 516-299-8455
When you call, you will be speaking with a representative ready to dispatch a team to assess your property damage and begin the mitigation and restoration process.
Choosing the right restoration company in an emergency can be the difference between a minor setback and a long-term problem. For New Yorkers, particularly those in Nassau County and throughout Long Island, Sea Cliff Restoration offers a compelling combination of technical skill and customer-focused service.
Their ability to handle complex and interrelated problems—such as the attic mold that stemmed from an unknown roof leak, or the immediate water extraction required after a pipe burst in a crawl space—showcases their versatile expertise. The explicit mention of successfully killing all the mold and repairing damaged structural parts, as reported by one customer, underscores their commitment to providing a complete, lasting solution, not just a surface-level fix. Furthermore, the quick arrival and smooth handling of a water emergency, as praised by another client, confirm their operational efficiency when time is of the essence.
A significant benefit for clients is the guidance the company provides beyond their core work, such as recommending other trusted professionals (e.g., for insulation replacement). This holistic approach helps homeowners manage the entire recovery process, saving them time and additional stress. When you are facing property damage in the New York area, you need a partner who is prompt, professional, thorough, and ready to go the extra mile to ensure your property is restored safely and completely. Sea Cliff Restoration embodies this essential partnership, making them a worthwhile choice for fire damage, water damage, and mold remediation needs. Their location in Sea Cliff and their reputation for effective, comprehensive restoration work make them a reliable resource for emergency property recovery across Long Island.
Sea Cliff Services
Fire Damage Restoration Service
- Fire damage cleanup & repair
Sea Cliff Details
Accessibility
- Wheelchair accessible parking lot
Sea Cliff Location
Sea Cliff Reviews
moldwallspriceefficiencyleakatticinsulationdustdryingpipe
★ 5★ 4★ 3★ 2★ 1Attic was rife with mold because of a roof leak I didn’t know about. Insulation, beams—everything was covered. Fortunately, Sea Cliff Restoration was able to kill all the mold and repair the parts of the structure that had been damaged. Then they recommended a company that later replaced the insulation. It was just over $2,000 for this job. My husband and I agree our money was well spent.
Sep 26, 2025 · Aiyana HowardOur crawl space was flooded after a pipe burst, and I needed fast water damage restoration. The crew came quickly, pumped the water out, and set up drying equipment. I was surprised how smoothly they handled everything. The whole place looks safe and dry now, and I’m glad I called them right away.
Aug 28, 2025 · A Google UserOur dining room table had a watermark half its size. Our dog knocked over a vase on the table while we were on vacation. Sea Cliff Restoration didn’t have to take the table out of our house to restore it. Instead, they refinished it on the spot, in under two hours, and for a fair price.
Oct 01, 2025 · Simeon MosheWhen a heavy storm hit, water leaked through the roof and spread into the attic. I panicked because I saw boxes with family photos getting wet. I contacted the company for water damage cleanup and they arrived the same day. They carefully removed the wet insulation, set up drying machines, and made sure nothing dangerous like mold would develop. The workers were friendly and respectful, moving our belongings with care. Within a few days everything was dry, and the attic was usable again. I felt a huge relief knowing they saved things I thought were lost forever.
Aug 25, 2025 · A Google UserMy appreciation for A2Z Restoration Services knows no bounds. I timed them during their last job: they removed over two inches of water from a large factory floor in just under 80 minutes. I could say “great job,” but they’re well aware of how impressive that was.
Jul 21, 2025 · William Cope
More Water Damage Restoration Near Me
Cleanworks5.0 (63 reviews)26 Albion Rd #201, Lincoln, RI 02865, USA
LocalFlow Restoration of Rhode Island5.0 (5 reviews)203 Reservoir Ave #3, Lincoln, RI 02865, USA
PRIME, LLC.4.0 (76 reviews)811 Park E Dr, Woonsocket, RI 02895, USA
SERVPRO of The Attleboros4.0 (18 reviews)679 Washington St Suite 8 #216, Attleboro, MA 02703, USA
Craftech4.0 (284 reviews)1 Walker Dr, Upton, MA 01568, USA
Disaster Restoration Services5.0 (1 reviews)9 Rosenfeld Dr, Hopedale, MA 01747, USA
Green Home Solutions of North Attleboro4.0 (28 reviews)1A Spaceway Ln, Hopedale, MA 01747, USA
J Brian Day Emergency Service4.0 (121 reviews)240 Maple St, Bellingham, MA 02019, USA
Next Level4.0 (27 reviews)42 Commonwealth Ave Unit 3, North Attleborough, MA 02763, USA
ATA Fire and Flood Restoration4.0 (21 reviews)837 Upper Union St C19 C19, Franklin, MA 02038, USA
Flood Fire Pro4.0 (134 reviews)852 Upper Union St, Franklin, MA 02038, USA
Restoration & Remediation Today5.0 (1 reviews)23 N Main St #2, Attleboro, MA 02703, USA
Categories
Top Visited Sites
SERVPRO of South Palm Beach4.0 (204 reviews)
BBH Remediation3.0 (16 reviews)
5 Star Air and Water5.0 (2 reviews)
Tech Medics4.0 (218 reviews)
Rainbow Restoration of Northeast Indianapolis5.0 (5 reviews)
PuroClean of Silicon Beach5.0 (3 reviews)Top Water Damage Restoration Searches
Trending Damage Repair Guides Posts
The Link Between Water Damage and Long-Term Structural Issues: What You Need to Know
Water Damage Restoration Tips for Older Homes | Fix Water Damage Effectively
Water Damage and Mold: How to Address Both Issues
Water Damage Repair for Hardwood and Laminate Floors: A Complete Guide
How to Dry Out Water-Damaged Rugs Quickly: Best Methods & Tips
Top 5 Water Damage Restoration Myths Debunked
