Fiber Dry Carpet & Upholstery Cleaning Photos










Fiber Dry Carpet & Upholstery Cleaning Introduce
For residents and business owners across Ohio’s Miami Valley, finding a reliable, effective, and health-conscious cleaning service for your valuable carpets, rugs, and upholstery can be a major challenge. Many traditional methods, often referred to as "steam cleaning," soak your carpets, leaving them damp for days and creating the potential for mildew, shrinkage, or quick re-soiling due to chemical residue. Fiber Dry Carpet & Upholstery Cleaning in Dayton offers a specialized solution to these common issues, utilizing a proprietary dry cleaning approach that prioritizes quick drying times and a healthier home environment.
While the term “laundry” typically refers to clothing care, Fiber Dry handles the specialized “laundry” needs of your home’s largest textiles and surfaces—your carpets and furniture. Their unique process has established them as a premier choice for homeowners and property managers throughout the Dayton region who seek a superior clean without the inconvenience of excessive moisture or harsh chemicals. It is a family-owned business deeply committed to quality service, transparent pricing, and old-fashioned values, which together create an exceptional customer experience that has earned them a loyal following across the expansive Ohio service area.
Location and Accessibility
Fiber Dry Carpet & Upholstery Cleaning is strategically located in the heart of the region, allowing them to dispatch their professional, bonded, and insured technicians efficiently across a significant portion of Southwest Ohio. Their central office and base of operations is situated in Dayton, Ohio, a key city for accessibility throughout the Miami Valley.
The physical address for their operations is:
334 Linden Ave, Dayton, OH 45403, USA
This Dayton location serves as the hub for their impressive service area, which spans over 1,700 square miles. This extensive reach caters to communities both large and small, ensuring that high-quality, dry carpet and upholstery cleaning is available to a large segment of the Ohio population. Customers in major corridors and outlying areas, from Sidney down to Monroe, and from Eaton across to Springfield, can all benefit from the convenience of their mobile service. It is worth noting that while their coverage is extensive, a higher minimum charge may apply for customers located in the more distant outlying areas to ensure fair scheduling and resource allocation.
Services Offered
Fiber Dry offers a comprehensive suite of professional cleaning services designed to revitalize both residential and commercial properties. Their expertise extends beyond standard floor care to include specialized cleaning for delicate and high-touch home furnishings. The core of their business is built around their innovative low-moisture dry carpet cleaning method, but they are fully equipped to handle a variety of surfaces and challenging stains.
UL
LI Carpet Cleaning Service
LI Residential Carpet Cleaning: Deep Restorative Cleaning using their signature dry carpet cleaning process.
LI Commercial Carpet Cleaning and Maintenance: Specialized services for businesses, property management, and commercial carpet maintenance.
LI Area Rugs and Carpets And Rugs Cleaning.
LI Odor Control and Pet Odor Treatment: Addressing severe pet problem and pet stains, including specialized treatment for cat urine and other pets urine odors.
LI Water Damage Services: Including Emergency Cleanup, Water And Flood Damage, Flood Restoration, Storm Damages, and addressing Sewer Backup issues to dry out damp carpeting.
LI Specialty Spotting and Stain Treatment: Expert removal of difficult spots, dye stains, grease remover, and other special stain problems.
LI Additional Floor Services
LI Tile & Grout Cleaning: Including cleaning grout lines on ceramic tile and other tile floors.
LI Upholstery Cleaning Service
LI Furniture Upholstery: Comprehensive cleaning for upholstered furniture, including sofas, love seats, recliners, and other upholstered fabrics.
LI Furniture Cleaning and Fabric Cleaning, with the option for Fabric Protector Applied.
LI Leather Cleaning Service
LI Leather Cleaning & Restoration: Care for leather furniture and leather upholstery in both commercial and residential settings.
/UL
Features / Highlights
Fiber Dry's success in the competitive Ohio cleaning market is driven by several key features that distinguish their service from traditional hot water extraction (steam cleaning) methods. Their dedication to a superior, consumer-friendly approach makes their service a compelling choice for health-conscious and busy Ohio families.
UL
LI The Dry Carpet Cleaning Advantage: The core method utilizes an organic, nanotechnology-based treatment and a gentle scrubbing process with absorbent pads, effectively lifting dirt, stains, and moisture. This process is highly effective soil removal without soaking the carpet or padding.
LI Rapid Drying Time: A significant benefit for any household, most carpets cleaned by Fiber Dry are completely dry within two hours. This is in stark contrast to traditional steam cleaning, which can leave carpets damp for 12 to 24 hours. The rapid drying time virtually eliminates the risk of mildew growth and allows for immediate use of the space.
LI Healthier and Safer Solutions: The proprietary cleaning solutions are a green carpet cleaning process, free of harsh detergents. They are safe for children, pets, and individuals with allergies, contributing to a healthier indoor air quality in your home.
LI No Sticky Residue: Since the method avoids harsh soaps, there is no sticky residue left behind. Traditional residues attract new dirt, causing carpets to re-soil quickly. Fiber Dry’s process keeps your carpets cleaner for a longer period.
LI Guaranteed Transparency: The company operates on a foundation of upfront pricing, ensuring "No hidden charges, No Up-sells, No Bait & Switch, No Games!" They only charge for the residential carpet area actually cleaned, measuring around large furniture pieces that are not moved.
LI Highly Experienced Technicians: Many of the carpet cleaners employed by Fiber Dry are qualified, bonded, and insured professionals with over twenty years of experience in rug and upholstery cleaning, ensuring every job, from a simple spot clean to deep restorative cleaning, is handled with expertise.
LI Exclusive Customer Guarantee: Fiber Dry stands behind its work with an exclusive 10-Day 100% Clean Carpet Guarantee. If a customer is unhappy with the results of any cleaned carpet, tile, or upholstery within ten days, they will return to re-clean it free of charge.
/UL
Contact Information
For residents across the Dayton metro and surrounding Ohio communities seeking estimates or to schedule a service, Fiber Dry maintains accessible and responsive contact channels.
P Address: 334 Linden Ave, Dayton, OH 45403, USA
P Phone: (937) 781-9005
P This local Dayton phone number connects you directly to their team for scheduling, detailed pricing inquiries, or discussions regarding complex projects like flood restoration or commercial carpet maintenance plans. The commitment to professionalism is evident from the first point of contact, ensuring a smooth and reliable process from booking to the final post cleaning inspection.
What is worth choosing
In the crowded carpet cleaning landscape of Ohio, Fiber Dry Carpet & Upholstery Cleaning stands out not just for its technology, but for its core values. It is the quality of the "whole experience," as they put it, that converts first-time customers into "cheerleaders." Customer reviews frequently highlight the professionalism and courteous nature of the cleaning team—such as Mike and Chris, often mentioned by name—who take the time to explain the step cleaning process thoroughly. This level of personalized, respectful service is a rarity in today’s fast-paced business environment.
The commitment to an organic, low-moisture, and residue-free process is particularly valuable to Ohioans concerned about their family's health. Pet owners, allergy sufferers, and parents of young children can rest easy knowing that the cleaning fluid and cleaning solutions are safe and non-toxic. The speed of the dry carpet cleaning process is a practical advantage that cannot be overstated, especially for commercial clients or families with heavy traffic areas, minimizing disruption and down-time. Moreover, the transparent, square-footage-based pricing structure—40 cents per square foot for residential carpet cleaning with a modest minimum—ensures customers pay only for the clean floor area they receive, reinforcing the company’s promise of integrity and trust. Choosing Fiber Dry means investing in a cleaner, healthier, and drier home with a local, family-focused business that genuinely cares about delivering lasting value to the Ohio community.
Fiber Dry Carpet & Upholstery Cleaning Services
Carpet Cleaning Service
- Carpet steam cleaning
- Area Rugs
- Carpet Cleaner In
- Carpet Cleaning Process
- Carpet Cleaning Upholstery Cleaning
- Carpet Grooming
- Carpet Mats
- Carpet Protector
- Carpet Stain
- Carpets And Rugs
- Cat Urine
- Ceramic Tile
- Clean Floor
- Clean Grout Lines
- Cleaning Apply
- Cleaning Fluid
- Cleaning Solutions
- Cleaning Urine Stains
- Commercial Carpet Cleaning
- Commercial Carpet Maintenance
- Commercial Leather Cleaning
- Complete Clean
- Damp Carpeting
- Deep Restorative Cleaning
- Desk Chairs
- Difficult Spots
- Dining Room Chairs
- Dry Carpet Cleaning
- Dry Out
- Dye Stains
- Emergency Cleanup
- Experienced Cleaners
- Fabric Cleaning
- Fabric Protector Applied
- Flood Restoration
- Furniture Cleaning
- Furniture Moving
- Furniture Upholstery
- Grease Remover
- Hard Surfaces
- Hardwood Floors
- Heavy Traffic Areas
- Job Cleaning
- Leather Cleaning & Restoration
- Leather Furniture
- Leather Upholstery
- Love Seat
- New Carpet
- Occasionally Cleaning
- Odor Control
- Other Floor Coverings
- Pet Odor Treatment
Our technicians at Fiber Dry are specially trained to locate all pet stains using high powered ultra violet lamps. Through our cleaning process, infected areas are specially treated and removed.
- Pet Problem
- Pet Spot
- Pet Stains
- Pets Urine
- Planned Maintenance
- Post Cleaning
- Post Groom
- Property Management
- Protected Carpets
- Regular Cleaning
- Remove Spots
- Removes Dirt
- Residential Carpet
- Rug And Upholstery Cleaning
- Service Calls
- Sewer Backup
- Soil Extraction
- Soil Removal
- Special Stain
- Specialty Spotting
- Spot Clean
- Stain Removal
- Stain Treatment
- Steam Cleaning
- Step Cleaning
- Step Cleaning Process
- Storm Damages
- Tile & Grout Cleaning
We use the best equipment to remove the dirt, grease, and grime from residential and commercial tile. We only use green certified products to aid in the removal of stubborn soils from your tile
- Tile Cleaners
- Tile Floors
- Upholstered Fabrics
- Upholstered Furniture
- Upholstery Cleaning
Don’t let just anyone clean your sensitive fabrics! The technicians at Fiber Dry are experienced in cleaning the finest of upholstered fabrics.
- Upholstery Cleaning Process
- Vacuum Cleaner
- Water And Flood Damage
- Water Damage Restoration
- Water Damage Services
Fiber Dry Carpet & Upholstery Cleaning Details
Accessibility
- Wheelchair accessible parking lot
Fiber Dry Carpet & Upholstery Cleaning Location
Fiber Dry Carpet & Upholstery Cleaning
334 Linden Ave, Dayton, OH 45403, USA
Fiber Dry Carpet & Upholstery Cleaning Reviews
companytechniciansgentlemancrewquestionsdry cleanedcallwaterpropertycompetitor
★ 5★ 4★ 3★ 2★ 1Great service! Professional, personable and willing to share each step of the process so I had an understanding of the dry carpet cleaning. Mike and Chris worked efficiently as a team. I would recommend Fiber Dry for any carpet cleaning services to anyone!
Oct 01, 2025 · David BroadwaterNew customer, I received a call with estimated arrival time. Cleaning process was explained to me. Questions were answered in a polite and professional manner with a smile. Prices are great. Carpet looks brand new. I will definitely use Fiber Dry again.
Sep 23, 2025 · Jill HamerFirst time using Fiber Dry, and let me say it won't be the last! Great communication prior to the appointment. Crew of 3 showed up on time. They were very polite, friendly & professional. Carpets turned out great! Spots are gone, and traffic patterns reduced. Carpet dried much more quickly than other procedures. Prices are reasonable. No complaints!
Jun 18, 2025 · William MunasMike and his crew are exceptional at all levels. They are experienced, courteous and do a wonderful job on my carpets with very little water in a short period of time.I have used Fiberdry many times and highly recommend them.
Aug 19, 2025 · Paul SteinWe have been having our carpets cleaned by Fiber Dry for many years. The technicians (Mike and Scott) are professional, courteous and efficient! We've never had a problem and we've always been satisfied. We've referred others to the company and will continue to do so. Thank you!
May 19, 2025 · diane tousignant
More Water Damage Restoration Near Me
SERVPRO of Beckley4.0 (22 reviews)416 City Ave, Beckley, WV 25801, USA
Novos Remediation5.0 (3 reviews)915 Johnstown Rd, Beckley, WV 25801, USA
Rife Remodeling & Flooring4.0 (84 reviews)1161 2nd St, Richlands, VA 24641, USA
Appalachian Disaster Recovery & Janitorial Services Inc5.0 (1 reviews)325 Ingleside Rd, Princeton, WV 24740, USA
Davis Brothers Roofing and Sheet Metal Fabricators, Inc.4.0 (92 reviews)305 Messick Ave, Church Hill, TN 37642, USA
Tri Cities Paint Pros4.0 (20 reviews)213 Emmett St, Kingsport, TN 37665, USA
Southwest Emergency Restoration LLC0.0 (0 reviews)14063 Porterfield Hwy, Abingdon, VA 24210, USA
AFS Foundation & Waterproofing Specialists4.0 (47 reviews)317 Shelby St, Kingsport, TN 37660, USA
All American Initiative, Inc.5.0 (49 reviews)P.O. Box 7865, Kingsport, TN 37664, USA
Go Dry Waterproofing4.0 (19 reviews)1165 Shipp St, Kingsport, TN 37660, USA
Appalachian Property Solutions3.0 (11 reviews)1744 Fort Henry Dr, Kingsport, TN 37664, USA
Wirelessville4.0 (200 reviews)1233 N Eastman Rd #320, Kingsport, TN 37664, USA
Categories
Top Visited Sites
Service Restoration5.0 (2 reviews)
Trident0.0 (0 reviews)
A.S.A.P. Restoration Corp.4.0 (93 reviews)
Flood Restoration Nyc0.0 (0 reviews)
Bordi Restoration2.0 (3 reviews)
Property Restoration Specialties5.0 (4 reviews)Top Water Damage Restoration Searches
Trending Damage Repair Guides Posts
Water Damage Restoration for Crawl Spaces
What Are the Signs of Water Damage That Homeowners Often Miss?
How to Safely Remove Standing Water From Your Home
How to Repair Water-Damaged Electrical Systems Safely
How to Handle Water Damage From Burst Water Heaters: Tips and Solutions
How to Handle Water Damage From Plumbing Failures: A Step-by-Step Guide
