Pure Maintenance of Texas Photos










Pure Maintenance of Texas Introduce
Introduction / Overview
For homeowners and businesses across the greater Texas region, maintaining a healthy, safe, and structurally sound property is a top priority. In an environment like ours, characterized by high humidity and occasional severe weather, dealing with water intrusion and subsequent mold growth is an all-too-common challenge. This is where a truly specialized and multi-faceted consultant, like Pure Maintenance of Texas, steps in to provide innovative solutions.
Located conveniently in Sugar Land, Pure Maintenance of Texas is far more than a standard remediation company. They position themselves as an essential partner for residents, offering a unique blend of services spanning environmental consulting, water damage restoration, and general contracting. Their core focus, and the technology that truly sets them apart, is their patented Dry Fog Mold Remediation system. This revolutionary approach is changing the game for Texans dealing with mold issues, promising a comprehensive, non-invasive, and rapid path to a healthier indoor environment.
As a women-owned business, Pure Maintenance of Texas is dedicated to professional, high-quality service, utilizing EPA-approved solutions to address microbial issues in air and on surfaces. They understand the impact that mold and poor indoor air quality can have on a family's health and are committed to restoring properties quickly and effectively, often without the need for the disruptive and costly demolition associated with traditional methods. This commitment to efficiency, affordability, and the use of cutting-edge technology makes them a standout provider in the Texas market for anyone seeking a "demolition-free mold remediation" solution.
Location and Accessibility
Pure Maintenance of Texas has established its headquarters in the heart of the thriving Sugar Land, Texas community, making it highly accessible for residents throughout the Houston metropolitan area and beyond. This central location ensures that their specialized teams can quickly dispatch to homes and businesses experiencing water damage or mold issues, which is crucial for minimizing long-term structural and health concerns.
The main office is conveniently situated at:
56 Sugar Creek Center Blvd #160, Sugar Land, TX 77478, USA
Being located within a major suburban hub like Sugar Land provides easy access to major Texas highways, enabling their crews to serve not just Fort Bend County but also the wider regional area, including Houston, Stafford, Bellaire, Pearland, and Pasadena. For customers planning to visit the office for a consultation or to meet with the team, the facility is designed with convenience in mind, offering a:
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Furthermore, the company is highly engaged with modern service options, offering online estimates to begin the consultation process remotely, which adds a layer of convenience for busy Texans needing a quick assessment of their property issues.
Services Offered
Pure Maintenance of Texas provides a robust suite of services that spans across environmental health, property restoration, and general construction, offering a complete solution for property owners in the region. Their offerings are categorized into key areas:
Water Damage Restoration and Mold Remediation Services:
- Dry Fog Mold Remediation and Removal (Demolition-Free Sugar Land Mold Remediation And Removal)
- Complete Mold Remediation and Mold Abatement
- Mold Inspection, Mold Assessment, and Mold Testing
- Water damage-related cleanup and repair
- Water damage-related mold removal and Mold Mitigation
- Flood restoration and Water Intrusion services
- HVAC Mold Remediation and Air Ducts treatment
- Air Quality Testing and Air Filtration solutions
- Black Mold treatment and Fungus Treatment
- Odor Remediation and Odor Removal
- Pathogen Removal, Disinfection & Sterilization Services
- Mold Prevention and Regular Maintenance/Inspections
Contracting and Restoration Services (Building Restoration):
- General construction and General repairs
- Exterior structural repairs and Interior structural repairs
- Drywall installation and Drywall repair (including Water Damaged Drywall patches)
- Flooring and Flooring repair (including Tile work replacement)
- Concrete pouring
- Exterior painting
- Plumbing services, Plumbing fixture installation, and Repair water fixtures
- Waterproofing services
Environmental Consultant Services:
- Free Consultation and Free Inspections And Estimates
- Mold Education and guidance on Mold Exposure and Mold Infestation
- Guidance on Preventing Water Damage
Features / Highlights
The approach taken by Pure Maintenance of Texas to mold and microbial issues is defined by several innovative and customer-centric features, making them a preferred choice for many in the Houston area:
- Patented Dry Fog Technology: The cornerstone of their service is the Dry Fog Mold Remediation System. This technology uses microscopic particles of an EPA-registered sterilant that creates a vapor, which can penetrate deep into materials, walls, fabrics, and the HVAC system to eliminate mold spores and pathogens without causing any moisture damage or leaving residue. Unlike traditional fogging, the droplets are so small they do not wet surfaces.
- Demolition-Free Remediation: A major advantage for homeowners is the ability to eradicate mold without tearing out walls, flooring, or other structural elements. This saves significant time, hassle, and the financial burden of costly reconstruction and displacement.
- Speed and Efficiency: Traditional mold remediation can take weeks, but the Dry Fog process is typically completed in just a few hours. Customers can often return to their home on the same day, significantly minimizing disruption to daily life.
- Affordable Solutions: Due to the reduced labor and lack of demolition, their services are often reported to be significantly less expensive—in some cases, less than half the cost—of conventional mold removal companies.
- Comprehensive Coverage: The ultra-penetrating dry fog ensures that all areas of a property are treated, including the hard-to-reach places like inside wall cavities, air ducts, and deep within porous materials, leading to highly effective and guaranteed results.
- Safety First: The solutions used in the Dry Fog system, such as InstaPURE™ and EverPURE™, are EPA-approved, non-toxic, and safe for furniture, electronics, and plants. The company is committed to using products that are family and pet friendly.
- Full-Service Capability: Beyond mold, they offer full contracting and water damage restoration services. This means they can inspect, remediate the mold/water issue, and then provide the necessary structural repairs, offering a single point of contact for the entire restoration process.
- NORMI Certified: Their technicians are trained and certified through the National Organization of Remediators and Microbial Inspectors (NORMI), ensuring adherence to high professional standards.
Contact Information
If you are a Texas resident in need of immediate assistance, a complimentary mold inspection, or a detailed consultation, you can reach Pure Maintenance of Texas using the following information:
Address:
56 Sugar Creek Center Blvd #160, Sugar Land, TX 77478, USA
Phone:
(281) 220-1425
What is Worth Choosing
In the humid climate of Texas, where water damage and mold issues are a constant threat to indoor air quality and structural integrity, choosing the right partner for remediation is critical. Pure Maintenance of Texas stands out as the clear choice for several compelling reasons, particularly its focus on non-invasive, technologically advanced solutions.
The most significant advantage is their commitment to the patented Dry Fog Technology. While traditional mold removal often involves tear-out—which means quarantining sections of your house, days or weeks of contractors, and the massive expense of rebuilding—Pure Maintenance of Texas provides a rapid, whole-home treatment that is demolition-free. This not only dramatically cuts down on time and cost but also eliminates the logistical nightmare of temporarily relocating your life.
The process is incredibly thorough; the microscopic fog particles penetrate every square inch of the property, from the deepest corners of the HVAC system to behind walls and into your personal belongings. This level of comprehensive coverage is what provides peace of mind, knowing that both visible and hidden mold spores and pathogens are eliminated. Furthermore, the two-step treatment includes a preventive application (EverPURE™) that creates an antimicrobial barrier to inhibit future microbial regrowth, offering a long-term solution rather than a temporary fix.
Customers consistently praise the professionalism, speed, and effectiveness of the service. As one local client, Gus, noted, he was "extremely helpful and knowledgeable on mold issues and goes the extra mile... to successfully eliminate it," even taking the time to sand a cabinet to ensure the mold was completely exposed to the product. This dedication to going "the extra mile" is a key indicator of their commitment to customer satisfaction and a truly healthy outcome. For a safe, fast, less-invasive, and ultimately more affordable path to a mold-free and healthier home environment in Texas, Pure Maintenance of Texas offers a revolutionary service that is truly worth choosing.
Pure Maintenance of Texas Services
Contractor
- Concrete pouring
- Drywall installation
- Drywall repair
- Exterior painting
- Exterior structural repairs
- Flooring
- Flooring repair
- General construction
- General repairs
- Interior structural repairs
- Plumbing fixture installation
- Plumbing services
- Repair flooring
- Repair water fixtures
- Tile work replacement
- Waterproofing
Water Damage Restoration Service
- Flood restoration
- Mold cleaning
- Mold damage restoration
- Mold inspection
- Mold mitigation
- Mold remediation
- Water damage-related cleanup & repair
- Water damage-related mold removal
- Air Conditioning
- Air Ducts
- Air Filtration
- Air Quality Testing
- Black Mold
- Cleaning And Maintenance
- Cleaning And Remediation
- Commercial
- Complete Mold Remediation
- Demolition Free Mold Remediation
- Demolition Free Sugar Land Mold Remediation And Removal
- Disinfection & Sterilization
- Disinfection And Sterilization
- Disinfection Services
- Dry Fog Mold Remediation
- Dry Fog Mold Removal
- Dry Fog System
- Dry Fog Technology
- Dry Fogging
- Drywall Patches
- Free Consultation
- Free Inspections
- Free Inspections And Estimates
- Free Mold Remediation
- Fungus Treatment
- HVAC Mold Remediation
- Hepa Filters
- Home Remediation
- Hvac Ductwork
- Mold Abatement
- Mold Assessment
- Mold Damage
- Mold Education
- Mold Exposure
- Mold Infestation
- Mold Inspection
- Mold Issue
- Mold Issues
- Mold Prevention
- Mold Prevention And Removal
- Mold Remediation
- Mold Remediation & Removal
- Mold Remediation / Inspection
- Mold Remediation And Removal
- Mold Remediation Jobs
- Mold Remediation Process
- Mold Remediation Solution
- Mold Removal And Remediation
- Mold Removal Method
- Mold Removal Process
- Mold Restoration
- Mold Testing
- Odor Remediation
- Odor Removal
- Pathogen Removal
- Preventing Water Damage
- Regular Inspections
- Regular Maintenance
- Residential
- Start Restoring
- Water Damaged Drywall
- Water Intrusion
Pure Maintenance of Texas Details
From the business
- Identifies as women-owned
Service options
- Online estimates
- Onsite services
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
Pure Maintenance of Texas Location
Pure Maintenance of Texas
56 Sugar Creek Center Blvd #160, Sugar Land, TX 77478, USA
Pure Maintenance of Texas Reviews
mold remediationhomefogginghealthysmellinvasivepricingknowledgeinspectioncost
★ 5★ 4★ 3★ 2★ 1Gus was amazing! He took care of the mold problem in my house quickly and did a super thorough job. He was friendly, easy to work with, and made the whole process stress-free. My home feels so much better now. I’d absolutely recommend Gus and his company to anyone who needs mold remediation.
Aug 10, 2025 · Cindi SimpsonWe were very pleased with Pure Maintenance. Gus is extremely helpful and knowledgeable on mold issues and goes the extra mile on helping in any way he can to successfully eliminate it from your residence. He even took the extra measure of sanding down the inside of a cabinet ( that we had painted over some mold) to ensure the mold would be completely exposed to the product used in the fogging process. Overall, we’re very pleased and if we ever have an issue again we won’t hesitate to call Pure Maintenance.
Jul 18, 2025 · Cindy PrattAnother great experience with Pure Maintenance! They came and did a remediating treatment on our home to kill mold. It was about a 4 hour process. Our home is small 3 bdrm. But it was timely, clean work. The treatment they use is not harmful so you can be in your house immediately after they finish. Very thankful to have had this done!! Would highly recommend!!
Oct 02, 2025 · Micah WierI dealt with so many different type of contractors for mold inspection, plumbing, electrician, roofers, and etc. But Gus from Pure Maintenance was the best contractor i have ever worked with. Setting up schedule was easy, he showed up on time, he gave us honest opinions and options, and also they are much more affordable and less invasive than any other mold remediation companies in town. Seriously, if you have a mold issues, call Gus and find out how he can help!
Jul 17, 2025 · David SuhI have worked with Gus twice recently while moving out of my apartment with mold and for remediation consultation at a new home purchase during my option period. He is very knowledgeable, informative and will answer every question. Besides being personable, his prices are very reasonable, too!
Aug 09, 2025 · Connie Eaton
More Water Damage Restoration Near Me
Case Water Damage Restoration Specialists5.0 (14 reviews)12700 Exchange Dr #559, Stafford, TX 77477, USA
PuroClean of Sugar Land South4.0 (73 reviews)2245 Texas Dr, Sugar Land, TX 77479, USA
SERVPRO of Stafford, Missouri City North5.0 (9 reviews)3945 Greenbriar Dr Suite A10, Stafford, TX 77477, USA
American Water Damage of Houston4.0 (136 reviews)12783 Capricorn St #100, Stafford, TX 77477, USA
Steamatic of Southwest Houston5.0 (59 reviews)13000 Murphy Rd # 130, Stafford, TX 77477, USA
United Water Restoration Group of Missouri City5.0 (67 reviews)13313 Redfish Ln Suite 104, Stafford, TX 77477, USA
Elite Sugar Land5.0 (1 reviews)2743 Imperia Dr, Sugar Land, TX 77498, USA
New Era Steam Cleaning And Restoration5.0 (75 reviews)8310 Twining Trail Ln, Sugar Land, TX 77479, USA
RestoPros of West Houston4.0 (35 reviews)10193 W Grand Pkwy S Suite #103 Box 221, Richmond, TX 77407, USA
JD Restorations of Houston5.0 (11 reviews)11391 Meadowglen Ln # H, Houston, TX 77082, USA
Buffalo Home Remodeling & Remediation Services4.0 (200 reviews)9809 Harwin Dr. Ste J, Houston, TX 77036, USA
NEKO5.0 (1 reviews)302 Morton St, Richmond, TX 77469, USA
Categories
Top Visited Sites
BMS CAT3.0 (7 reviews)
Stanley Steemer4.0 (1806 reviews)
SERVPRO of East Glendale5.0 (6 reviews)
DynaClean Professional Services5.0 (29 reviews)
Pronto Pack Out4.0 (120 reviews)
ServiceMaster by JLK - Fire and Water Damage Restoration5.0 (1 reviews)Top Searches
Trending Damage Repair Guides Posts
Water Damage Repair for Subflooring Under Carpets
How to Handle Water Damage After a Storm: A Step-by-Step Guide
Water Damage Restoration for Restaurants and Food Service Areas – A Complete Guide
How to Deal With Water Damage From Roof Ice Dams: Prevention and Repair Tips
What to Do if Your Roof Is Leaking and Causing Water Damage Inside
How to Restore Water-Damaged Rugs and Carpets 
